Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,101 – 2,115 of 1,661,089 results

2,101

Invitrogen™ MOG Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q16653, Q61885, Q63345
Isotype	IgG
Concentration	500 μg/mL
Antigen	MOG
Gene Symbols	MOG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	B230317G11Rik; BTN6; BTNL11; DAQB-92E24.2; dystonia 2, torsion (autosomal recessive); MGC26137; MOG; MOG alpha 6; MOG alpha-5; MOG alpha-6; MOG AluA; MOG AluB; MOG Ig AluB; MOG Ig-AluB; MOGIG2; MOGIG-2; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; NRCLP7
Gene	MOG
Product Type	Antibody
Gene ID (Entrez)	17441, 24558, 4340
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).
Classification	Polyclonal
Primary or Secondary	Primary

2,102

Invitrogen™ IL-2 Monoclonal Antibody (5355)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P60568
Isotype	IgG2a
Concentration	0.5 mg/mL
Antigen	IL-2
Gene Symbols	IL2
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	aldesleukin; cytokine; H-IL-2; il 2; Il2; Il-2; ILN; Interleukin; interleukin 2; interleukin 2 precursor; interleukin 2 variant IL2delta2; Interleukin2; Interleukin-2; interleukin-2 precursor; interleukin-2 precursor protein; interleukin-2; interleukin 2; Involved in regulation of T cell clonal expansion; involved in regulation of T-cell clonal expansion; lymphokine; M-IL-2; patial sequence of Interleukin-2; POIL2; porcine Interleukin 2; T cell growth factor; T-cell growth factor; T-cell growth factor (TCGF); TCGF
Gene	IL2
Product Type	Antibody
Gene ID (Entrez)	3558
Formulation	PBS with 5% trehalose and No Preservative
Immunogen	E. coli-derived recombinant human IL-2 Ala21-Thr153.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5355

2,103

Invitrogen™ ALOX15 Monoclonal Antibody (OTI7H6)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P16050, P39654, Q02759
Isotype	IgG2b
Concentration	1.0 mg/mL
Antigen	ALOX15
Gene Symbols	Alox15
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	12/15-lipoxygenase; 12/15-LO; 12/15-LOX; 12-LO; 12-LOX; 15-lipooxygenase-1; 15-LOX; 15-LOX-1; 15LOX-1; 15-LOX2; Alox12; Alox12l; Alox15; Arachidonate 12-lipoxygenase, leukocyte-type; arachidonate 15-lipoxygenase; Arachidonate omega-6 lipoxygenase; L-12LO; LOG15
Gene	Alox15
Product Type	Antibody
Gene ID (Entrez)	11687, 246, 81639
Formulation	PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3
Immunogen	Full length human recombinant protein of ALOX15 produced in HEK293T cell.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OTI7H6

2,104

Invitrogen™ CD4 Monoclonal Antibody (CT-4), APC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Avian,Chicken
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	0
Isotype	IgG1 κ
Concentration	0.1 mg/mL
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	101790140, 395362
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.5
Immunogen	Chicken thymocytes and Ig-negative blood leukocytes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CT-4

2,105

Invitrogen™ P-Glycoprotein Monoclonal Antibody (UIC2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation
Form	Liquid
Gene Accession No.	P08183
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	P-Glycoprotein
Gene Symbols	ABCB1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ABC superfamily; P-glycoprotein; ABC20; ABCB1; Abcb1a; Abcb1b; Abcb4; ATP binding cassette subfamily B member 1; ATP-binding cassette sub-family B (MDR/TAP) member 1 (P-glycoprotein/multidrug resistance 1); ATP-binding cassette sub-family B member 1; ATP-binding cassette sub-family B member 1A; ATP-binding cassette sub-family B member 1B; ATP-binding cassette transporter subfamily B, member 1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; ATP-binding cassette, sub-family B (MDR/TAP), member 1 (P-glycoprotein/multidrug resistance 1); ATP-binding cassette, subfamily B (MDR/TAP), member 1A; ATP-binding cassette, sub-family B (MDR/TAP), member 1A; ATP-binding cassette, subfamily B (MDR/TAP), member 1B; ATP-binding cassette, sub-family B (MDR/TAP), member 1B; ATP-binding cassette, sub-family B (MDR/TAP), member 4; ATP-binding cassette, subfamily B, member 1A; ATP-binding cassette, subfamily B, member 1B; ATP-dependent translocase ABCB1; ATP-dependent translocase ABCB1; multidrug resistance protein 1; bovine p-glycoprotein; CD243; CLCS; colchicin sensitivity; doxorubicin resistance; ecotropic viral integration site 32; Evi32; GP170; mdr; Mdr1; MDR1A; Mdr1b; Mdr3; mdr-3; multi-drug resistance 3; multidrug resistance p-glycoprotein; multidrug resistance protein 1; Multidrug resistance protein 1A; multidrug resistance protein 1B; Multidrug resistance protein 2; multidrug resistance protein 3; multidrug resistance protein MDR1; multiple drug resistant 1a; P glycoprotein 1; P glycoprotein 3; P-glycoprotein; P-glycoprotein 1; P-glycoprotein 2; P-glycoprotein 3; P-glycoprotein/multidrug resistance 1; Pgp; p-gp; PGP1; PGP2; PGY1; Pgy-1; Pgy1-1; PGY2; Pgy3; Pgy-3; Phospholipid transporter ABCB1
Gene	ABCB1
Product Type	Antibody
Gene ID (Entrez)	5243
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	NIH 3T3 cells transfected with human CD243 (MDR-1) cDNA.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UIC2

2,106

Invitrogen™ ATF6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot
Form	Liquid
Gene Accession No.	F6VAN0, O35451, P18850, Q99941
Isotype	IgG
Concentration	1 mg/mL
Antigen	ATF6
Gene Symbols	ATF6, ATF6B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9130025P16Rik; 9630036G24; AA617266; AA789574; ACHM7; activating transcription factor 6; activating transcription factor 6 alpha; Activating transcription factor 6 beta; ATF 6; Atf6; ATF6 alpha; ATF6A; Atf6alpha; ATF6-alpha; Atf6b; ATF6beta; ATF6-beta; cAMP response element binding protein-related protein; cAMP response element-binding protein-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; Crebl1; Creb-related protein; CREB-RP; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 beta; DKFZp686P2194; ESTM49; FLJ21663; G13; Processed cyclic AMP-dependent transcription factor ATF-6 alpha; Processed cyclic AMP-dependent transcription factor ATF-6 beta; Protein G13
Gene	ATF6B
Product Type	Antibody
Gene ID (Entrez)	12915, 1388, 226641, 22926
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide from near the amino terminus of human ATF6.
Classification	Polyclonal
Primary or Secondary	Primary

2,107

Invitrogen™ RIP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q13546, Q60855
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	RIP1
Gene Symbols	RIPK1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	cell death protein RIP; D330015H01Rik; FLJ39204; OTTHUMP00000015955; receptor (TNFRSF)-interacting serine-threonine kinase 1; receptor interacting serine/threonine kinase 1; receptor-interacting protein 1; receptor-interacting protein kinase 1; receptor-interacting serine/threonine-protein kinase 1; Rinp; RIP; RIP1; RIP-1; RIP1 (CT); RIPK1; serine/threonine-protein kinase RIP
Gene	RIPK1
Product Type	Antibody
Gene ID (Entrez)	19766, 306886, 8737
Formulation	PBS with 0.02% sodium azide
Immunogen	A 15 amino acid peptide from near the amino terminus of human RIPK1.
Classification	Polyclonal
Primary or Secondary	Primary

2,108

Invitrogen™ HTR2A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P14842, P28223
Isotype	IgG
Concentration	500 μg/mL
Antigen	HTR2A
Gene Symbols	Htr2a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A
Gene	Htr2a
Product Type	Antibody
Gene ID (Entrez)	29595, 3356
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
Classification	Polyclonal
Primary or Secondary	Primary

2,109

Invitrogen™ SHP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P35235, P41499, Q06124
Isotype	IgG
Concentration	500 μg/mL
Antigen	SHP2
Gene Symbols	PTPN11
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg
Gene	PTPN11
Product Type	Antibody
Gene ID (Entrez)	19247, 25622, 5781
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human SHP2 (582-597aa RVYENVGLMQQQKSFR).
Classification	Polyclonal
Primary or Secondary	Primary

2,110

IL-4 Monoclonal Antibody (MP4-25D2), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Rat
Conjugate	Functional Grade
Applications	Functional Assay,Neutralization
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P05112
Concentration	1 mg/mL
Antigen	IL-4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Il4
Product Type	Antibody
Gene ID (Entrez)	3565
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MP4-25D2

2,111

Invitrogen™ Cytokeratin 7 Monoclonal Antibody (OV-TL12/30)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	2-8°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P08729
Isotype	IgG1
Concentration	0.03755 mg/mL
Antigen	Cytokeratin 7
Gene Symbols	KRT7
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	CK7; CK-7; Cytokeratin 7; cytokeratin-7; D15Wsu77e; K2C7; K7; Kb7; keratin 7; keratin 7, type II; keratin associated protein 7.1; keratin complex 2, basic, gene 7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; keratin, type II cytoskeletal 7; Keratin-7; keratin-associated protein 7-1; keratin-associated protein 7-1-like protein; Krt2-7; KRT7; krt7 {ECO:0000250; LOC100755511; LOC100861181; NACHT, LRR and PYD domains-containing protein 3; sarcolectin; SCL; si:ch73-233m11.1; si:ch73-233m11.2; similar to keratin 7; type II keratin Kb7; type II mesothelial keratin K7; type-II keratin Kb7; UniProtKB:P08729}
Gene	KRT7
Product Type	Antibody
Gene ID (Entrez)	3855
Formulation	PBS with 1% BSA and 0.1% sodium azide
Immunogen	OTN11 human ovarian carcinoma cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OV-TL12/30

2,112

Invitrogen™ RyR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	E9Q401, Q92736
Isotype	IgG
Concentration	1.22 mg/mL
Antigen	RyR2
Gene Symbols	Ryr2
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	9330127I20Rik; ARVC2; ARVD2; calcium release channel; cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; cardiac ryanodine receptor 2; cardiac-type ryanodine receptor; hRYR-2; islet-type ryanodine receptor; kidney-type ryanodine receptor; Ryanodine receptor; ryanodine receptor 2; ryanodine receptor 2 (cardiac); ryanodine receptor 2, cardiac; ryanodine receptor type 2; ryanodine receptor type II; RyR; RYR2; RYR-2; Type 2 ryanodine receptor; VTSIP
Gene	Ryr2
Product Type	Antibody
Gene ID (Entrez)	20191, 6262
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

2,113

Invitrogen™ CD11c Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P20702, Q9QXH4
Isotype	IgG
Concentration	1.79 mg/mL
Antigen	CD11c
Gene Symbols	Itgax
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene	Itgax
Product Type	Antibody
Gene ID (Entrez)	16411, 3687, 499271
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Recombinant protein (or fragment).
Classification	Polyclonal
Primary or Secondary	Primary

2,114

Invitrogen™ EpoR Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14753, P19235, Q07303
Isotype	IgG
Concentration	1.16 mg/mL
Antigen	EpoR
Gene Symbols	EPOR
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	EPO R; EPOR; EPO-R; Erythropoietin receptor; pEpoR
Gene	EPOR
Product Type	Antibody
Gene ID (Entrez)	13857, 2057, 24336
Formulation	PBS with 50% glycerol and 0.01% thimerosal; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

2,115

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	O14974
Isotype	IgG
Concentration	0.24 mg/mL
Antigen	Phospho-MYPT1 (Ser507)
Gene Symbols	PPP1R12A
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Gene	PPP1R12A
Product Type	Antibody
Gene ID (Entrez)	4659
Formulation	PBS with 50% glycerol and 0.01% thimerosal; pH 7.3
Immunogen	Synthetic peptide
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ MOG Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-2 Monoclonal Antibody (5355) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ALOX15 Monoclonal Antibody (OTI7H6) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (CT-4), APC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ P-Glycoprotein Monoclonal Antibody (UIC2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ATF6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RIP1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HTR2A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SHP2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Cytokeratin 7 Monoclonal Antibody (OV-TL12/30) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RyR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11c Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EpoR Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MOG Polyclonal Antibody

Invitrogen™ IL-2 Monoclonal Antibody (5355)

Invitrogen™ ALOX15 Monoclonal Antibody (OTI7H6)

Invitrogen™ CD4 Monoclonal Antibody (CT-4), APC

Invitrogen™ P-Glycoprotein Monoclonal Antibody (UIC2)

Invitrogen™ ATF6 Polyclonal Antibody

Invitrogen™ RIP1 Polyclonal Antibody

Invitrogen™ HTR2A Polyclonal Antibody

Invitrogen™ SHP2 Polyclonal Antibody

Invitrogen™ Cytokeratin 7 Monoclonal Antibody (OV-TL12/30)

Invitrogen™ RyR2 Polyclonal Antibody

Invitrogen™ CD11c Polyclonal Antibody

Invitrogen™ EpoR Polyclonal Antibody

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody